PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5832.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 405aa    MW: 43822.7 Da    PI: 5.7235
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5832.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.21.9e-50221491128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdee++++yL +k  + ++   +++ evd++++eP+dLp k++ +ekewyfF+++d ky+tg+r+nratk+gyWkatgkd+e+++   +
  MLOC_5832.1  22 LPPGFRFHPTDEEIITCYLLRKFLDPSFVS-RAVGEVDLNSCEPRDLPGKANMGEKEWYFFVHKDLKYPTGSRANRATKEGYWKATGKDREIFKPrAR 118
                  79*************************888.88***************99999****************************************98677 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  elvg+kktLvfy+grap+g k++Wvmhe+rl
  MLOC_5832.1 119 ELVGMKKTLVFYTGRAPRGAKSEWVMHEFRL 149
                  88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5820173IPR003441NAC domain
PROSITE profilePS5100556.36222173IPR003441NAC domain
PfamPF023652.2E-2623149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MVESIAAGAG SEEQGRGGGL SLPPGFRFHP TDEEIITCYL LRKFLDPSFV SRAVGEVDLN  60
SCEPRDLPGK ANMGEKEWYF FVHKDLKYPT GSRANRATKE GYWKATGKDR EIFKPRAREL  120
VGMKKTLVFY TGRAPRGAKS EWVMHEFRLQ GKSRDQTMNN PKDEWVVCKV FNKKGEAKAA  180
RDADVDAEYS AVTTPNASSV VDAGEGAGDF TDSMFTIDPL YIPNSDEYTS NQLPAETTTT  240
TNTNGDPPPY NADYYYPSVP TTAGSFNVMS NYSLTNAPSN AQTATAMASS VPATSGSSWQ  300
HMLMNTAPHG GMVMGRRSYD VNLHEQQAIM VRALGGAVGA QNFGEPANGL QLPSSAVTTG  360
NVLPQQGKLG SYDDGGEFPY GNYDLASAAM NGRPAAANNP GARFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-492017815170NO APICAL MERISTEM PROTEIN
1ut4_B5e-492017815170NO APICAL MERISTEM PROTEIN
1ut7_A5e-492017815170NO APICAL MERISTEM PROTEIN
1ut7_B5e-492017815170NO APICAL MERISTEM PROTEIN
4dul_A5e-492017815170NAC domain-containing protein 19
4dul_B5e-492017815170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3711560.0AK371156.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2126K19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977422.11e-108PREDICTED: NAC domain-containing protein 77-like
SwissprotQ5CD174e-93NAC77_ORYSJ; NAC domain-containing protein 77
TrEMBLF2E4T20.0F2E4T2_HORVD; Predicted protein
STRINGMLOC_5832.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51203063
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.13e-72NAC family protein